PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G003200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 558aa    MW: 60572.1 Da    PI: 5.4382
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G003200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-174087148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT  Ed +lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Aqcoe2G003200.2.p 40 KGPWTSTEDAILVDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 87
                       79******************************************9986 PP

2Myb_DNA-binding52.21.4e-1693136146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
  Aqcoe2G003200.2.p  93 KGAFTAEEEHKIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 136
                        799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6093587IPR017930Myb domain
SuperFamilySSF466898.61E-3039134IPR009057Homeodomain-like
SMARTSM007177.2E-153989IPR001005SANT/Myb domain
PfamPF002492.9E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-234194IPR009057Homeodomain-like
CDDcd001672.18E-114287No hitNo description
PROSITE profilePS5129425.98388142IPR017930Myb domain
SMARTSM007171.4E-1592140IPR001005SANT/Myb domain
PfamPF002491.4E-1593136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-2695141IPR009057Homeodomain-like
CDDcd001672.72E-1195136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MSGTTSESDD GVLSKDQTDS SSFDEGSCGG SIGGGTVLKK GPWTSTEDAI LVDYVKKHGE  60
GNWNAVQKHS GLFRCGKSCR LRWANHLRPN LKKGAFTAEE EHKIIELHAK MGNKWARMAA  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PDVRLQAYSE NQKAQNTNDF NGGDTHHVMQ  180
ASNFDIPEVI FDHLKSNQGV LSYAPPLPDI SLGSMLNHGL GSSQNYSFMS HTMHQHKRLR  240
GSEILFPGFN STVTNAFAPL DLFQNDTCGK TNQSFGSTFP YDPDPNGKNP STFGMIPGSH  300
AILNGNFSTS KPIPRSLKLE LPSLQYPETD LGSWGMSSSQ PPSLDSVDAF IQSPSPTRPV  360
QSDCVSPRNS GLLDALLHES QTLSSAKNQS SEKSSNSCVV TPGDIVDSSA LNVCEAEWEE  420
YGDPISPLGR SAASVFSECT PASGSSLDET PAGRALCGSE VKQEPIEHVT TPDEGRQITP  480
QLSFPRPDAL LDGAWFEQRS ECAKDQSVLA DAISTFIGED FYGDYKQIPA ASSNQGWGGG  540
SYFWNNLPAV CQMSELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31381415107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251854.10.0PREDICTED: transcription factor GAMYB
RefseqXP_010251855.10.0PREDICTED: transcription factor GAMYB
RefseqXP_010251856.10.0PREDICTED: transcription factor GAMYB
TrEMBLA0A067L7W60.0A0A067L7W6_JATCU; MYB family protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-123myb domain protein 65